PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS65377.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 386aa    MW: 41110.7 Da    PI: 7.5975
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS65377.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.28.8e-14132178147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+eE+  ++++ ++lG+g+W+ Iar     Rt+ q+ s+ qky
       EPS65377.1 132 RVPWTEEEHRMFLQGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 178
                      789*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.96127183IPR017930Myb domain
SMARTSM007173.5E-11131181IPR001005SANT/Myb domain
SuperFamilySSF466894.74E-16132182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-12132177IPR009057Homeodomain-like
PfamPF002493.8E-12132178IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.1E-19132182IPR006447Myb domain, plants
CDDcd001674.88E-10134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDVSIRKSAS MGNLSHYAGG GSGNAIQQNG  60
VAHDSPGDTP DHPSAGSGAP DGYASEDCVA GPSSTRERKK GRLVSLEPSS FFQNLPFQEA  120
IQIFIAFANS LRVPWTEEEH RMFLQGLQKL GKGDWRGIAR NYVISRTPTQ VASHAQKYFI  180
RQCNVSRRKR RSSLFDIVAD ESADAPVMSR DFFPLKGETQ SGGTALEPVA MEEDCESMES  240
ANSNEAEPAN PPAKESSSPS PSSQFPPFPI VYPAYVAAPV FQLPVPFWAA AAAEGFGTAG  300
PESCGTGEKE EEAHEVVKPT AVVHSKNPIN VDELVGMSKL SIGGGLSLKL SRPSAFHANN  360
PPAGSASSSS SNSSSSSSRN PKIHAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081287.11e-147PREDICTED: uncharacterized protein LOC105164353
TrEMBLS8DZE00.0S8DZE0_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000674891e-135(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.14e-93MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]